PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_016464
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family LBD
Protein Properties Length: 185aa    MW: 20577.9 Da    PI: 7.8596
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_016464genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260126.41.3e-39411401100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+l++kC +dC+lapyfp e+ ++f  vhk+FGa++v+kll+++ +++r++++s+lvyeA+ar+rdPvyG+vg i+ lq q+e+l++el++++
  DCAR_016464  41 PCAACKFLKKKCRPDCILAPYFPPEELQNFISVHKIFGATRVSKLLNEVLPHQRDETLSCLVYEAQARLRDPVYGSVGAISMLQLQVERLQKELDAAN 138
                  7*********************************************************************************************9998 PP

       DUF260  99 ee 100
                  +e
  DCAR_016464 139 AE 140
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.81340141IPR004883Lateral organ boundaries, LOB
PfamPF031954.5E-3841138IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MESEFLRLSS NFNLTVIDFD GSIVVRTNAA SFNAVRYNYS PCAACKFLKK KCRPDCILAP  60
YFPPEELQNF ISVHKIFGAT RVSKLLNEVL PHQRDETLSC LVYEAQARLR DPVYGSVGAI  120
SMLQLQVERL QKELDAANAE LVNYACGYNH CCCHLDMGGS TAALPAPSAC LKIQCVIMLR  180
FHHK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ1483972e-61FJ148397.1 Daucus carota subsp. sativus clone BAC C055M03 genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002300051.12e-54LOB domain protein 25
SwissprotQ9FML44e-52LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLA0A061FUD55e-54A0A061FUD5_THECC; Lateral organ boundaries domain family protein
TrEMBLB9GI562e-54B9GI56_POPTR; LOB domain protein 25
TrEMBLB9I3C86e-54B9I3C8_POPTR; Uncharacterized protein
TrEMBLB9S6404e-54B9S640_RICCO; LOB domain-containing protein, putative
TrEMBLF6GSI85e-54F6GSI8_VITVI; Putative uncharacterized protein
TrEMBLM1BJE07e-54M1BJE0_SOLTU; Uncharacterized protein
TrEMBLW9S0S73e-54W9S0S7_9R
STRINGVIT_17s0000g09010.t011e-53(Vitis vinifera)
STRINGPOPTR_0001s35280.16e-54(Populus trichocarpa)
STRINGPOPTR_0012s08540.12e-53(Populus trichocarpa)
STRINGPGSC0003DMT4000466442e-53(Solanum tuberosum)
STRINGOB01G14220.16e-53(Oryza brachyantha)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.42e-53LBD family protein